Back to News
34.2 Patch Notes: Battlegrounds, Arena and Gameplay Updates
December 1, 2025By Blizzard Entertainmentpatch

34.2 Patch Notes: Battlegrounds, Arena and Gameplay Updates

The most impactful change in Hearthstone Battlegrounds is the introduction of the Timewarped Tavern system, which offers unique cards and mechanics, significantly altering gameplay dynamics.
```html

New System: Timewarped Tavern

With Murozond locked in a time-bending battle against the Bronze Dragonflight, the Tavern is feeling the effects of this chronal conflict. To help in the fight to save time, Nozdormu is opening a special Timewarped Tavern to arm players with cards infused with temporal magic. This unique shop features alternate timeline versions of familiar cards, and you may even encounter a few from timelines that have never been seen before.

Timewarped Tavern

The Timewarped Tavern appears twice per game, offering a fresh selection of five special cards each time. A Minor Timewarp occurs on Turn 6, and a Major Timewarp occurs on Turn 9. The cards in this shop are ones you don't normally find in the tavern:

  • Unique minions
  • Unique spells
  • Alternate versions of existing cards
  • Second hero powers (Minor Timewarp only)
Timewarped Pagle Timewarped Sporebat Timewarped Dragonling Timewarped Trainee Power of Zephrys Three Wishes

When you enter the Timewarped Tavern, you receive two Chronum, a new currency used to buy cards instead of Gold. Cards in the shop cost one or two Chronum, and any unspent Chronum disappear at the end of the turn, so spend wisely!

The Timewarped Tavern operates under its own set of rules:

  • You cannot Freeze or Refresh the Timewarped Tavern.
  • Your hand, board, and hero power do not function here.
  • If buying cards causes you to exceed your hand limit, your hand limit will be temporarily increased to accommodate those cards.
  • Timewarped cards cannot Triple with their regular versions. (e.g., Timewarped Busker can only Triple with two more Timewarped Buskers, not with Southsea Busker.)

Keep an eye out for Nozdormu, the big bronze dragon running the show, and help save the timelines!

Hero Updates

New Heroes

Murozond and Chromie are taking their fight to the Tavern! These new heroes will appear in every game for the first two weeks of Season 12.

Murozond, Unbounded (15 Armor)

Murozond, Unbounded

This Murozond is Unbounded by the rules and sneaks you into the Timewarped Tavern for an extra visit on Turn 8.

Time Twister Chromie (15 Armor)

Time Twister Chromie

Use Time Twister Chromie’s chronomancy to replace your Tavern with a fresh selection of Tavern Spells.

Hero Changes

Sylvanas Windrunner - Reclaimed Souls

  • Old: [2 Gold]
  • New: [3 Gold]
  • Diff: Cost increased from 2 to 3 Gold.

Scabbs Cutterbutter - I Spy

  • Old: [2 Gold]
  • New: [3 Gold]
  • Diff: Cost increased from 2 to 3 Gold.

Tess Greymane - Bob's Burgles

  • Old: [1 Gold]
  • New: [2 Gold]
  • Diff: Cost increased from 1 to 2 Gold.

Reno Jackson - Gonna Be Rich!

  • Old: Once per game, make a friendly minion Golden.
  • New: Once per game, make a friendly minion Golden. (Except Timewarped minions.)
  • Diff: Now excludes Timewarped minions from being made Golden.

Zerek, Master Cloner - Cloning Gallery

  • Old: Once per game, summon an exact copy of a friendly minion.
  • New: Once per game, summon an exact copy of a friendly minion. (Except Timewarped minions.)
  • Diff: Now excludes Timewarped minions from being cloned.

Dinotamer Brann - Battle Brand

  • Old: After you buy 5 Battlecry minions, get a Brann Bronzebeard. (Once per game.)
  • New: After you buy 4 Battlecry minions, get a Brann Bronzebeard. (Once per game.)
  • Diff: Requirement reduced from 5 to 4 Battlecry minions.
brannbronzebeard

Kael'thas Sunstrider - Verdant Spheres

  • Old: After you buy 3 minions, get a Gold Coin.
  • New: After you buy 3 minions, get a Tavern Coin.
  • Diff: Reward changed from Gold Coin to Tavern Coin.
taverncoin

Lord Barov - Friendly Wager

  • Old: Guess which player will win their next combat. If you're correct, get 3 Gold Coins.
  • New: Guess which player will win their next combat. If you're correct, get 3 Tavern Coins.
  • Diff: Reward changed from Gold Coins to Tavern Coins.

Kerrigan, Queen of Blades - Spawning Pool - Evolution Chamber

  • Old Spawning Pool: [7 Gold]
  • New Spawning Pool: [6 Gold]
  • Old Evolution Chamber: [9 Gold]
  • New Evolution Chamber: [8 Gold]
  • Diff: Spawning Pool cost decreased from 7 to 6 Gold; Evolution Chamber cost decreased from 9 to 8 Gold.
spawningpool

Thorim, Stormlord - Choose Your Champion

  • Old: Passive. At the start of the game, Discover a Tier 7 minion to get after you spend 55 Gold.
  • New: Passive. At the start of the game, Discover a Tier 7 minion to get after you spend 60 Gold.
  • Diff: Requirement increased from 55 to 60 Gold.

Loh, the Living Legend

  • Only restricted to Quilboar lobbies (no longer Dragon and Quilboar)
Loh, the Living Legend

Ozumat

  • No longer restricted to Beast lobbies
Ozumat

Forest Lord Cenarius

  • No longer restricted to Beast lobbies
Forest Lord Cenarius

Decreased Armor

Alexstrasza

High Rank: 7, Duos: 5

Buttons

High Rank: 14, Duos: 12

Cap'n Hoggarr

High Rank: 12, Duos: 10

Captain Eudora

High Rank: 10, Duos: 7

Cookie the Cook

High Rank: 7, Duos: 5

Death Speaker Blackthorn

High Rank: 16, Duos: 14

Dinotamer Brann

High Rank: 15, Duos: 13

Forest Lord Cenarius

High Rank: 12, Duos: 10

Forest Warden Omu

High Rank: 6, Duos: 5

Galakrond

High Rank: 14, Duos: 12

Guff Runetotem

High Rank: 8, Duos: 6

Millificent Manastorm

High Rank: 12, Duos: 10

Nozdormu

High Rank: 13, Duos: 10

Patches the Pirate

High Rank: 12, Duos: 10

Rock Master Voone

High Rank: 10, Duos: 8

Snake Eyes

High Rank: 5, Duos: 2

Teron Gorefiend

High Rank: 14, Duos: 12

Tess Greymane

High Rank: 12, Duos: 10

The Rat King

High Rank: 12, Duos: 10

Increased Armor

A. F. Kay

High Rank: 15, Duos: 13

Al'Akir

High Rank: 15, Duos: 13

Doctor Holli'dae

High Rank: 12, Duos: 10

E.T.C., Band Manager

High Rank: 14, Duos: 12

Kerrigan, Queen of Blades

High Rank: 12, Duos: 10

Kurtrus Ashfallen

High Rank: 12, Duos: 10

Lady Vashj

High Rank: 16, Duos: 14

Pyramad

High Rank: 14, Duos: 12

Queen Azshara

High Rank: 10, Duos: 8

Minion and Spell Updates

Removed Minions

  • Coilskar Sapper
  • Weary Mage
  • Divine Sparkbot
  • Felblaze Leader
  • Soul Juggler
  • Polarizing Beatboxer
  • Rot Hide Gnoll
  • Darkgaze Elder
  • Shoalfin Mystic
  • Eternal Summoner
  • Hungry Snapjaw
  • Whelp Smuggler
  • P-0UL-TR-0N
  • Disguised Graverobber
  • Rickety Repairbot
  • Piggyback Imp
  • Interrogator Whitemane
  • Mama Bear
  • Raptor Elder
  • Valiant Tiger
  • Sandstone Drake
  • Void Earl
  • Murky, Splash Fisher
  • Expert Technician
  • Nimble Hatchling
  • Shipwrecked Rascal
  • Flotsam Flinger
  • Golem Archivist
  • Grimscale Elegist
  • Greymane's Champion
  • Fauna Whisperer
  • Carapace Raiser
  • Kalecgos, Arcane Aspect
  • Gleaming Trader
  • Alleycat
  • Bigwig Bandit
  • Master of Realities
  • General Drakkisath
  • Vine Climber
  • Proud Privateer
  • Campfire Shadow
  • Charmwing
  • Molten Rock
  • Primeval Monstrosity
  • Hot-Air Surveyor
  • Mooneater's Champion
  • Crater Miner
  • Choral Mrrrglr
  • Oranomonos, the Wilted
  • Improviser
  • Holo Rover
  • Poetic Pen Pal
  • Stomping Stegodon
  • Silivaz the Vindictive
  • Super Constructor
  • Prodigious Tusker
  • Mummifier
  • Noisul of the Many Faces
  • Thieving Rascal
  • Adaptive Ancestor
  • Lost City Looter
  • Beacon of Hope
  • Elemental of Surprise
  • Showy Cyclist
  • Glim Guardian
  • Ruins Renovator
  • Glowgullet Warlord
  • Hog Watcher
  • Blazing Skyfin
  • Sky Admiral Rogers
  • Mechanized Gift Horse
  • False Implicator
  • Hawkstrider Herald
  • Lantern Lava
  • Friendly Bouncer
  • Greenskeeper
  • Nadina the Red
  • Southsea Busker
  • Lightfeather Screecher
  • Eternal Knight
  • Wizened Captain
  • Icky Imp
  • Azsharan Cutlassier
  • Scarlet Skull
  • Geared Guard
  • Bile Spitter
  • Whirring Protector
  • Sun-Bacon Relaxer
  • Cupcake Peddler
  • Ride-or-Die
  • Frantic Alarm-o-Bot
  • Wrathscale Rogue
coilskarsapperwearymagedivinesparkbotfelblazeleadersouljugglerpolarizingbeatboxerrothidegnolldarkgazeeldershoalfinmysticeternalsummonerhungrysnapjawwhelpsmugglerdisguisedgraverobberricketyrepairbotimppiggybackimpinterrogatorwhitemaneraptoreldervalianttigersandstonedrakemurkysplashfishermurkyexperttechniciannimblehatchlingshipwreckedrascalflotsamflingergolemarchivistgrimscaleelegistgreymaneschampionfaunawhisperercarapaceraiserkalecgosarcaneaspectgleamingtraderalleycatbigwigbanditmasterofrealitiesgeneraldrakkisathvineclimberproudprivateercampfireshadowshadowcharmwingmoltenrockprimevalmonstrositymonstrosityhotairsurveyormooneaterschampioncraterminerchoralmrrrglroranomonosthewiltedimproviserholoroverpoeticpenpalstompingstegodonsilivazthevindictivesuperconstructorprodigioustuskermummifiernoisulofthemanyfacesthievingrascaladaptiveancestorlostcitylooterbeaconofhopeelementalofsurpriseshowycyclistglimguardianruinsrenovatorglowgulletwarlordhogwatcherblazingskyfinskyadmiralrogersmechanizedgifthorsefalseimplicatorhawkstriderheraldlanternlavafriendlybouncergreenskeepernadinatheredsouthseabuskerlightfeatherscreechereternalknightwizenedcaptainazsharancutlassierscarletskullgearedguardbilespitterwhirringprotectorsunbaconrelaxercupcakepeddlerrideordiefranticalarmobotwrathscalerogue

New Minor Timewarped Minions (All Tier 3)

Timewarped Alleycat (Beast)

  • [2 Chronum] 5/5. At the end of your turn, summon a Tabbycat with this minion's stats.
tabbycat

Timewarped Leapfrogger (Beast)

  • [1 Chronum] 3/3.Taunt, Reborn. Deathrattle: Give a friendly Beast +1/+1 and this Deathrattle.

Timewarped Boar (Beast)

  • [1 Chronum] 1/1. Whenever every third friendly Timewarped Boar dies, get a random Golden Beast. (3 left!)

Timewarped Saurolisk (Beast)

  • [1 Chronum] 4/4. After you trigger a Deathrattle, gain +3/+3 permanently.

Timewarped Hyena (Beast)

  • [1 Chronum] 3/5. Whenever a friendly Beast dies, gain +2/+1 permanently.

Timewarped Sporebat (Beast)

  • [2 Chronum] 9/2. Taunt. Deathrattle: Get a random Tavern spell.

Timewarped Seer (Demon/Naga)

  • [2 Chronum] 8/6. One Tavern spell each turn costs (0). (1 left!)

Timewarped Rewinder (Demon)

  • [2 Chronum] 5/4. After your hero takes damage, rewind it and give your Demons +1 Health.

Timewarped Shadowdancer (Demon)

  • [2 Chronum] 6/5. Taunt. At the end of your turn, cast Staff of Enrichment.
staffofenrichment

Timewarped Devourer (Demon)

  • [1 Chronum] 5/5. At the start of your turn, consume the Demon to the right to gain its stats and 3 Gold.

Timewarped Kil'rek (Demon)

  • [2 Chronum] 4/7. Taunt. Deathrattle: Get a random Demon.

Timewarped Dragonling (Dragon)

  • [1 Chronum] 3/3. Start of Combat: Give this minion and its neighbors stats equal to your Tier.

Timewarped Low-Flier (Dragon)

  • [2 Chronum] 7/7. At the end of your turn, give +2 Attack to your minions with less Attack than this. Repeat with Health.

Timewarped Red Whelp (Dragon)

  • [1 Chronum] 4/6. Start of Combat: Deal 2 damage to two random enemy minions. (Improves after you play a Dragon!)

Timewarped Vaelastrasz (Dragon)

  • [2 Chronum] 6/6. Rally: Get a random Dragon.

Timewarped Whelp Smuggler (Neutral)

  • [2 Chronum] 3/8. Whenever a friendly minion gains Attack, give it +1 Health.

Timewarped Cyclone (Elemental)

  • [1 Chronum] 6/1. Divine Shield. Windfury. Reborn.

Timewarped Sellemental (Elemental)

  • [2 Chronum] 8/8. At the end of your turn, get a 3/3 Elemental.

Timewarped Ragnaros (Elemental)

  • [1 Chronum] 8/8. Start of Combat: Deal 8 damage to a random enemy minion.

Timewarped Snow Elemental (Elemental)

  • [1 Chronum] 6/5. The Tavern offers an extra Frozen Elemental whenever it is Refreshed.

Timewarped Upstart (Elemental)

  • [2 Chronum] 4/7. After the Tavern is Refreshed, double the Health of its right-most minion.

Timewarped Annoy-o-Tron (Mech)

  • [1 Chronum] 6/6. Taunt. Divine Shield. Reborn.

Timewarped Guard (Mech)

  • [2 Chronum] 3/7. Rally: Give a different friendly minion Divine Shield permanently.

Timewarped Copter (Mech)

  • [2 Chronum] 4/6. Avenge (3): Get a random Mech.
avenge

Timewarped Hunter (Mech)

  • [1 Chronum] 8/5. Battlecry and Deathrattle: Get a Pointy Arrow.
pointyarrow

Timewarped Sensei (Mech)

  • [2 Chronum] 4/4. At the end of your turn, give adjacent Mechs +3/+2.

Timewarped Mothership (Mech)

  • [2 Chronum] 5/7. Avenge (5): Get a random Protoss minion.

Timewarped Bassgill (Murloc)

  • [1 Chronum] 7/4. Deathrattle: Summon the highest-Health minion from your hand and give it Divine Shield for this combat only.

Timewarped Skipper (Murloc)

  • [2 Chronum] 5/6. After you sell a Tier 2 minion, get a random Tier 1 minion.

Timewarped Scourfin (Murloc)

  • [2 Chronum] 7/7. Taunt. Deathrattle: Give a random minion in your hand +7/+7 and summon it for this combat only.

Timewarped Murcules (Murloc)

  • [1 Chronum] 7/3. Divine Shield. Whenever this kills a minion, give the left-most minion in your hand +3/+3.

Timewarped Elegist (Murloc)

  • [2 Chronum] 3/5. At the end of your turn, give minions in your hand and board +2/+1.

Timewarped Commander (Naga)

  • [1 Chronum] 5/5. Spellcraft: Give a minion +2/+2 for each friendly Naga.

Timewarped Pashmar (Naga)

  • [2 Chronum] 6/7. Avenge (4): Get a random Spellcraft spell and Tavern spell.

Timewarped Archer (Naga)

  • [1 Chronum] 4/9. Spellcraft: Give a minion +12 Attack.

Timewarped Sapper (Naga)

  • [2 Chronum] 5/4. Taunt. Deathrattle: Get a Spitescale Special.
spitescalespecial

Timewarped Busker (Pirate)

  • [1 Chronum] 4/2. Battlecry and Deathrattle: Gain 1 Gold next turn.

Timewarped Nellie's Ship (Beast/Pirate)

  • [2 Chronum] 2/6. At the start of each turn, Discover a Pirate to crew the ship. Deathrattle: Summon and get that Pirate.

Timewarped Sailor (Pirate)

  • [1 Chronum] 5/4. Divine Shield. The Tavern offers an extra Pirate whenever it is Refreshed.

Timewarped Pagle (Pirate)

  • [2 Chronum] 8/6. Once per combat, when this attacks and kills a minion, get a Triple Reward.
triplereward

Timewarped Relaxer (Quilboar)

  • [1 Chronum] 3/4. When you sell this, it plays 1 Blood Gem on all your minions. (Improves each turn!)

Timewarped Piper (Quilboar)

  • [2 Chronum] 2/8. Whenever this takes damage, your Blood Gems give an extra +1 Attack this game. (3 times per combat.)

Timewarped Thorncaller (Quilboar)

  • [2 Chronum] 5/3. Battlecry and Deathrattle: Get a Blood Gem Barrage.

Timewarped Geomancer (Quilboar)

  • [1 Chronum] 2/9. Avenge (2): Get a Blood Gem.

Timewarped Jazzer (Quilboar)

  • [2 Chronum] 5/3. Deathrattle: Your Blood Gems give an extra +1 Health this game.

Timewarped Recycler (Undead)

  • [2 Chronum] 2/7. Avenge (6): Increase your maximum Gold by (1).

Timewarped Pillager (Undead)

  • [2 Chronum] 4/3. Taunt, Reborn. Deathrattle: Get a Tavern Coin.

Timewarped Deathswarmer (Undead)

  • [2 Chronum] 1/9. Whenever this takes damage, your Undead have +1 Attack this game (wherever they are).

Timewarped Jelly Belly (Undead)

  • [2 Chronum] 5/6. After a friendly minion is Reborn, give your minions +1/+2 permanently.

Timewarped Festergut (Undead)

  • [2 Chronum] 7/3. Deathrattle: Summon and get a random Undead Creation.

Timewarped Embalmer (Undead)

  • [2 Chronum] 9/9. One minion you play each turn gains Reborn. (1 left!)

Timewarped Lubber (Elemental/Pirate)

  • [1 Chronum] 5/7. The Tavern always offers 1 extra Tavern spell.

Timewarped Acolyte (Murloc)

  • [2 Chronum] 4/6. At the start of your turn, spin the Wheel of Yogg-Saron.

Timewarped Spirit of Air (Elemental)

  • [1 Chronum] 5/3. Deathrattle: Give a random friendly minion Windfury, Divine Shield, and Taunt.

Timewarped Lei (Neutral)

  • [2 Chronum] 3/5. At the start of your turn, get the Buddy of your Hero Power.

Timewarped Henchman (Neutral)

  • [2 Chronum] 5/7. After you kill a second minion each combat, get a plain copy of it.

Timewarped Botani (Neutral)

  • [2 Chronum] 8/6. At the end of your turn, get a random minion of your Tier.

Timewarped Arm (Neutral)

  • [2 Chronum] 8/8. Whenever a friendly minion is attacked, give it +8 Attack permanently.

Timewarped Winner (Neutral)

  • [1 Chronum] 6/6. Stealth. At the start of your turn, if this minion survived last combat, get a Triple Reward.

Timewarped Elise (Neutral)

  • [2 Chronum] 6/7. After you Refresh 5 times, make the highest-Tier minion in the Tavern Golden. (5 left!)

Timewarped Tipper (Neutral)

  • [2 Chronum] 3/4. If you have any unspent Gold at the end of your turn, get a random minion and Tavern spell.

New Minor Timewarped Spells (All Tier 3)

Timewarped Evolving Tavern

  • [1 Chronum] Get an Evolving Tavern. Repeat at the start of each turn.
evolvingtavern

Timewarped New Recruit

  • [1 Chronum] Give minions in the Tavern +1/+2 this game. The Tavern always has 7 cards this game.

Timewarped Big Winner!

  • [1 Chronum] Discover a Tier 3 Darkmoon Prize. Repeat at the start of every two turns.
prize

Timewarped Trainee

  • [1 Chronum] Get a random minion each from Tiers 1, 2, and 3.

Timewarped Ring

  • [1 Chronum] Get a Shiny Ring. Repeat at the start of each turn.
shinyring

Timewarped Lasso

  • [1 Chronum] Get an Enchanted Lasso. Repeat at the start of each turn.
enchantedlasso

Timewarped Investment

  • [1 Chronum] Casts When Bought. Gain 1 extra Chronum at your next Timewarp.

Timewarped Beanstalk

  • [2 Chronum] Discover a 1-cost card from the Major Timewarp. Lock it in your hand for 1 turn.

New Hero Powers (Minor Timewarp Only, All Tier 3)

Power of Al'Akir

  • [1 Chronum] Casts When Bought. Make 'Swatting Insects' your second Hero Power.
swattinginsects

Power of Elise

  • [1 Chronum] Casts When Bought. Make 'Lead Explorer' your second Hero Power.
leadexplorer

Power of George the Fallen

  • [1 Chronum] Casts When Bought. Make 'Boon of Light' your second Hero Power.
boonoflight

Power of Shudderwock

  • [2 Chronum] Casts When Bought. Make 'Snicker-Snack' your second Hero Power.
snickersnack

Power of Teron Gorefiend

  • [1 Chronum] Casts When Bought. Make 'Rapid Reanimation' your second Hero Power.
rapidreanimation

Power of the Lich King

  • [1 Chronum] Casts When Bought. Make 'Reborn Rites' your second Hero Power.
rebornrites

Power of Zephrys

  • [1 Chronum] Casts When Bought. Make 'Three Wishes' your second Hero Power.
threewishes

Power of Guff Runetotem

  • [2 Chronum] Casts When Bought. Make 'Natural Balance' your second Hero Power.
naturalbalance

Power of Flurgl

  • [1 Chronum] Casts When Bought. Make 'Gone Fishing' your second Hero Power.
gonefishing

Power of Sylvanas

  • [1 Chronum] Casts When Bought. Make 'Reclaimed Souls' your second Hero Power.
reclaimedsouls

Power of Tavish

  • [1 Chronum] Casts When Bought. Make 'Lock and Load' your second Hero Power.
lockandload

Power of Rakanishu

  • [1 Chronum] Casts When Bought. Make 'Tavern Lighting' your second Hero Power.
tavernlighting

New Major Timewarped Tavern Minions (All Tier 5)

Timewarped Lab Rat (Beast)

  • [2 Chronum] 12/8. After you cast a spell, give your Beasts +2/+2.

Timewarped Jungle King (Beast)

  • [2 Chronum] 8/12. After you summon a Beast, give it +2/+1. Improves after you cast a spell.

Timewarped Hawkstrider (Beast)

  • [2 Chronum] 8/4. Start of Combat: Trigger all friendly Deathrattles.

Timewarped Goldrinn (Beast)

  • [2 Chronum] 4/4. Deathrattle: Your Beasts have +2/+2 this game (wherever they are).

Timewarped Deadstomper (Beast/Undead)

  • [2 Chronum] 6/12. After you summon a minion, give your minions +3 Attack permanently.

Timewarped Tamuzo (Beast)

  • [1 Chronum] 5/5. After you summon a minion in combat, double its stats.

Timewarped Clefthoof (Beast)

  • [1 Chronum] 1/10. At the end of your turn, give your Beasts +1/+2 and deal 1 damage to them, three times.

Timewarped Overfiend (Demon)

  • [2 Chronum] 7/13. After you buy a card, give your Demons +2/+2.

Timewarped Imp-filtrator (Demon)

  • [2 Chronum] 13/7. After you spend 10 Gold, give minions in the Tavern +3/+3 this game. (10 Gold left!)

Timewarped Calligrapher (Demon)

  • [1 Chronum] 6/7. Battlecry, Deathrattle, and Rally: Get a random Tavern spell.

Timewarped Trickster (Demon)

  • [1 Chronum] 8/8. Deathrattle: Give this minion's maximum stats to another friendly minion.

Timewarped Shivarra (Demon)

  • [1 Chronum] 4/2. Divine Shield. Whenever a minion is consumed, this gains its stats.

Timewarped Archimonde (Demon)

  • [1 Chronum] 5/5. After your hero takes damage, rewind it and reduce the Cost of your next Tavern spell by (1).

Timewarped Kil'jaeden (Demon)

  • [2 Chronum] 7/7. The Tavern offers two extra Demons with +7/+7 after each Refresh. (Upgrades each turn!)

Timewarped Duskmaw (Dragon)

  • [2 Chronum] 6/14. Avenge (1): Give your Dragons +3/+3.

Timewarped Prismscale (Dragon)

  • [2 Chronum] 8/12. Avenge (3): Get a random Tavern spell that gives stats.

Timewarped Centurion (Dragon)

  • [2 Chronum] 8/8. After you cast a Tavern spell, get a new copy of it. (2 times per turn.)

Timewarped Poet (Dragon)

  • [1 Chronum] 6/7. Divine Shield. All your Dragons keep Bonus Keywords and stats gained in combat.

Timewarped Promo-Drake (Dragon)

  • [2 Chronum] 6/6. Start of Combat: Give your minions +2/+2. Improves after you spend 8 Gold. (8 left!)

Timewarped Hooktail (Dragon/Pirate)

  • [2 Chronum] 6/12. Whenever you cast a Tavern spell, give your minions +2/+1.

Timewarped Sea Glass (Elemental)

  • [1 Chronum] 10/8. Divine Shield. Rally: Double this minion's stats. (2 times per combat.)

Timewarped Behemoth (Elemental)

  • [2 Chronum] 9/11. Taunt. After you buy an Elemental, gain its stats.

Timewarped Stormcloud (Elemental)

  • [2 Chronum] 11/9. Deathrattle and Avenge (3): Get a Tavern Tempest.
taverntempest

Timewarped Molten Rock (Elemental)

  • [1 Chronum] 7/7. After you play an Elemental, gain +1/+1 and improve this.

Timewarped Substrate (Elemental)

  • [1 Chronum] 8/8. At the end of your turn, get a Temperature Shift.
temperatureshift

Timewarped Nomi (Neutral)

  • [2 Chronum] 10/10. After you play an Elemental, give minions in the Tavern +3/+2 this game.

Timewarped Ichoron (Elemental)

  • [1 Chronum] 7/4. Divine Shield. Whenever you play minion, give it Divine Shield.

Timewarped Steamer (Mech)

  • [2 Chronum] 13/7. At the end of your turn, get 2 random Magnetic Volumizers.

Timewarped Interpreter (Mech)

  • [2 Chronum] 6/8. Whenever you play or Magnetize a Mech, give your Mechs +3/+1.

Timewarped Probius (Mech)

  • [1 Chronum] 12/7. Magnetic. After you Magnetize this to a Mech, make it Golden.

Timewarped Grease Bot (Mech)

  • [1 Chronum] 6/12. Divine Shield. After a friendly minion loses Divine Shield, give your minions +2/+2 permanently.

Timewarped Whirl-O-Tron (Mech)

  • [1 Chronum] 7/5. Start of Combat: Copy your two left-most Deathrattles (except other Whirl-O-Trons).

Timewarped Electron (Mech)

  • [2 Chronum] 9/9. After you cast 2 Tavern spells, Magnetize a 3/3 Satelite to all your other Mechs. (2 left!)

Timewarped Murky (Murloc)

  • [1 Chronum] 5/5. At the end of your turn, gain +2/+2. (Improved by each Battlecry you've triggered this game!)

Timewarped Paleofin (Murloc)

  • [1 Chronum] 2/18. At the end of your turn, get a Cloning Conch.
cloningconch

Timewarped Squallfin (Murloc)

  • [2 Chronum] 6/14. After you play a Murloc, give minions in your hand and board +2/+1.

Timewarped Expeditioner (Murloc)

  • [2 Chronum] 6/12. Taunt, Divine Shield. After this gains stats, also give the stats to the two left-most minions in your hand.

Timewarped Murk-Eye (Murloc)

  • [2 Chronum] 12/5. At the end of your turn, trigger all friendly Battlecries.

Timewarped Painter (Murloc)

  • [2 Chronum] 4/9. At the end of your turn, give adjacent minions +2/+2. (Improved by cards from Tier 3 or below played this turn!)

Timewarped Mystic (Murloc)

  • [2 Chronum] 6/6. After you sell 3 Murlocs, your Tavern spells give an extra +1/+1 this game. (3 left!)

Timewarped Mrrrglr (Murloc)

  • [2 Chronum] 10/10. Start of Combat: Give adjacent minions the stats of all the minions in your hand.

Timewarped Karathress (Naga)

  • [2 Chronum] 14/6. After you summon a minion in combat, get a copy of Deep Blues.
deepblues

Timewarped Siren (Naga)

  • [2 Chronum] 6/14. After you play a Naga, give all your Naga +2/+4.

Timewarped Glowscale (Naga)

  • [1 Chronum] 6/12. Taunt. Spellcraft: Give a minion Divine Shield.

Timewarped Pioneer (Naga)

  • [1 Chronum] 4/13. After you Refresh 3 times, get a random Spellcraft spell. (3 left!)

Timewarped Secretary (Naga)

  • [1 Chronum] 5/11. After you cast 2 Spellcraft spells, get a random Tavern spell. (2 left!)

Timewarped Summoner (Naga/Elemental)

  • [2 Chronum] 6/9. Spellcraft: Choose a minion. Transform all minions in the Tavern into ones of its type, keeping Tiers.

Timewarped Riplash (Naga)

  • [1 Chronum] 13/5. Deathrattle: Get a copy of the last Tavern spell you cast.

Timewarped Raider (Pirate)

  • [2 Chronum] 14/6. After you play a card from Tier 4 or above, give your Pirates +3/+3.

Timewarped Plunderer (Pirate)

  • [2 Chronum] 15/5. Deathrattle: Increase your maximum Gold by 2.

Timewarped Sylvar (Pirate)

  • [2 Chronum] 7/10. At the end of your turn, give adjacent minions +4/+4. Repeat for each friendly Golden minion.

Timewarped Tony (Pirate)

  • [2 Chronum] 12/6. Deathrattle: Get a copy of Eyes of the Earth Mother.
eyesoftheearthmother

Timewarped Peggy (Pirate)

  • [2 Chronum] 9/5. Whenever a card is added to your hand, give your other Pirates +1/+1.

Timewarped Tide Razor (Neutral)

  • [2 Chronum] 12/8. Deathrattle: Summon and get 3 random Pirates.

Timewarped Lil' Quilboar (Quilboar)

  • [1 Chronum] 5/5. Reborn. Deathrattle: This plays 3 Blood Gems on all your Quilboar.

Timewarped Bloodbinder (Quilboar)

  • [2 Chronum] 12/8. At the start of each turn, get 5 Blood Gems. They also count as Tavern spells.

Timewarped Bandit (Quilboar)

  • [2 Chronum] 7/13. At the start of your turn, discard a spell to play 4 Blood Gems on all your minions.

Timewarped Twirler (Quilboar)

  • [2 Chronum] 7/5. After 2 Blood Gems are played on this, cast Blood Gem Barrage. (2 left!)

Timewarped Bristler (Quilboar)

  • [1 Chronum] 6/6. Deathrattle: Give this minion's Blood Gems to 2 different friendly Quilboar.

Timewarped Bonker (Quilboar)

  • [2 Chronum] 7/14. Windfury. Rally: This plays 2 permanent Blood Gems on all your other minions.

Timewarped Gemsplitter (Quilboar)

  • [2 Chronum] 5/10. Divine Shield. After a friendly minion loses Divine Shield, your Blood Gems give an extra +1 Attack this game.

Timewarped Anub'arak (Undead)

  • [2 Chronum] 12/8. After you play an Undead, your Undead have an extra +1 Attack this game.

Timewarped Geist (Undead)

  • [1 Chronum] 10/6. Deathrattle: Your Tavern spells give an extra +1/+1 this game.

Timewarped Radio Star (Undead)

  • [2 Chronum] 1/1. Deathrattle: Get a copy of the enemy minion that killed this with full Health and enchantments.

Timewarped Warghoul (Undead)

  • [1 Chronum] 9/3. Taunt. Deathrattle: Trigger an adjacent minion's Deathrattle (except Timewarped Warghoul).

Timewarped Ghoul-acabra (Undead/Beast)

  • [2 Chronum] 6/15. After you trigger a Deathrattle, give your minions +2/+2 permanently.

Timewarped Caretaker (Undead)

  • [2 Chronum] 6/6. Deathrattle: Summon six 1/1 Skeletons. Any that don't fit give your Undead +1 Attack this game (wherever they are).

Timewarped Greenskeeper (Dragon)

  • [2 Chronum] 7/11. Rally: Trigger your right-most Battlecry and Deathrattle.

Timewarped Chameleon (Beast)

  • [1 Chronum] 6/15. Start of Combat: Transform into a copy of the minion to the left of this.

Timewarped Immortal (Mech)

  • [1 Chronum] 8/8. Start of Combat: Gain the stats of adjacent minions.

Timewarped Scout (Neutral)

  • [1 Chronum] 7/7. When you sell this, get 1 random Tier 7 minion. (Improves each turn!)

Timewarped Viper (Neutral)

  • [1 Chronum] 8/8. Venomous. Immune while attacking.

Timewarped Ultralisk (Neutral)

  • [1 Chronum] 8/8. Also damages adjacent minions. Start of Combat: Double this minion's stats.

Timewarped Stoneshell (Neutral)

  • [1 Chronum] 4/8. Start of Combat: Copy all friendly Rallies (except other Stoneshells).

Timewarped Tender (Neutral)

  • [1 Chronum] 7/5. At the end of your turn, get 2 random Tavern spells that give stats.

Timewarped Nine Frogs (Beast)

  • [2 Chronum] 12/12. After you buy a minion, get a random Tavern spell from the same Tier. (9 left!)

Timewarped Theotar (All)

  • [2 Chronum] 8/8. After you play a minion with no type, give a friendly minion of each type +4/+4.

Timewarped Nalaa (Neutral)

  • [2 Chronum] 12/12. Whenever you cast a spell, give a friendly minion of each type +4/+4.

Timewarped Deios (Neutral)

  • [2 Chronum] 6/10. Your Battlecries, Deathrattles, and Rallies trigger twice.

New Major Timewarped Tavern Spells (All Tier 5)

Timewarped B.A.N.A.N.A.S.

  • [2 Chronum] Fill your hand with Tavern Dish Bananas. Your Tavern spells give an extra +2/+2 this game.
bananastaverndishbanana

Timewarped Thief

  • [1 Chronum] Discover a minion from your warband last game! Set its stats to 20/20.

Timewarped Ritual

  • [2 Chronum] Discover a Tier 7 minion. Get a random Tier 7 spell.

Timewarped On the House

  • [2 Chronum] Discover 2 minions from your Tier.

Timewarped Rat in a Cage

  • [1 Chronum] Give a minion +2/+2, then double its stats.

Timewarped Strike Oil

  • [2 Chronum] Increase your Maximum Gold by 3. Gain 3 Gold.

Timewarped Evolution

  • [1 Chronum] Choose a minion. Discover a Tier 6 minion to transform it into. It keeps its stats.

Timewarped Armor Stash

  • [1 Chronum] Casts When Bought. Gain 10 Armor.

Timewarped Special

  • [1 Chronum] Fill your hand with random Spellcraft spells.

Timewarped Conch

  • [1 Chronum] Choose a friendly Murloc. Summon an exact copy of it.

Timewarped Corpse

  • [1 Chronum] Discover a Deathrattle minion from Tier 5 or higher. Give it Reborn.

Timewarped Goldenizer

  • [2 Chronum] Choose a minion. Make it Golden.

Timewarped Chef's Choice

  • [2 Chronum] Choose a minion. Get a random minion of the same type from Tiers 4, 5, and 6.

Timewarped Cloning Device

  • [2 Chronum] Choose a friendly minion. Summon an exact copy of it.

New Pool Minions

Worgen Executive (Tier 2 Neutral)

  • 2/5. Rally: After the Tavern is Refreshed this game, give its right-most minion +1/+1.

Heroic Underdog (Tier 4 Neutral)

  • 1/10. Stealth. Rally: Gain the target's Attack.

Archaedas (Tier 6 Neutral)

  • 10/10. Battlecry: Get a random Tier 5 minion.

Flaming Enforcer (Tier 4 Demon/Elemental)

  • 4/5. At the end of your turn, consume the highest-Health minion in the Tavern to gain its stats.

Spirit Drake (Tier 4 Undead/Dragon)

  • 1/8. Avenge (3): Get a random Tavern spell.

Plankwalker (Tier 4 Undead/Pirate)

  • 6/4. Whenever you cast a Tavern spell, give three random friendly minions +2/+1.

Hardy Orca (Tier 3 Beast)

  • 1/6. Taunt. Whenever this takes damage, give your other minions +1/+1.

Hunting Tiger Shark (Tier 4 Beast)

  • 3/5. Battlecry: Discover a Beast.

Rabid Panther (Tier 6 Beast)

  • 4/8. After you play a Beast, give your Beasts +3/+3 and deal 1 damage to them.

Aranasi Alchemist (Tier 3 Demon)

  • 1/2. Taunt, Reborn. Deathrattle: Give minions in the Tavern +1 Health this game.

Twilight Hatchling (Tier 1 Dragon)

  • 1/1. Deathrattle: Summon a 3/3 Whelp that attacks immediately.

Whelp Watcher (Tier 2 Dragon)

  • 1/3. Rally: Summon a 3/3 Whelp to attack the target first.

Twilight Broodmother (Tier 4 Dragon)

  • 5/3. Deathrattle: Summon 2 Twilight Hatchlings. Give them Taunt.

Stuntdrake (Tier 6 Dragon)

  • 9/5. Avenge (3): Give this minion's Attack to two different friendly minions.

Waveling (Tier 3 Elemental)

  • 6/1. Deathrattle: After the Tavern is Refreshed this game, give its right-most minion +3/+3.

En-Djinn Blazer (Tier 4 Elemental)

  • 5/5. Battlecry: After the Tavern is Refreshed this game, give its right-most minion +6/+6.

Air Revenant (Tier 5 Elemental)

  • 3/6. After you spend 7 Gold, get Easterly Winds. (7 left!)

Acid Rainfall (Tier 6 Elemental)

  • 4/4. After you Refresh 3 times, gain the stats of the right-most minion in the Tavern. (3 left!)

Red Volumizer (Tier 2 Mech)

  • 3/1. Magnetic. The first time this is played or Magnetized, your Volumizers have +3 Attack this game (wherever they are).

Blue Volumizer (Tier 2 Mech)

  • 1/3. Magnetic. The first time this is played or Magnetized, your Volumizers have +3 Health this game (wherever they are).

Green Volumizer (Tier 2 Mech)

  • 2/2. Magnetic. The first time this is played or Magnetized, your Volumizers have +1/+1 this game (wherever they are).

Prehistoric Tinkerer (Tier 3 Mech)

  • 3/2. Divine Shield. After the Tavern is Refreshed, give its right-most minion Divine Shield.

Auto Accelerator (Tier 3 Mech)

  • 3/3. Battlecry: Get a random Magnetic Volumizer.

Conveyor Construct (Tier 4 Mech)

  • 5/2. Deathrattle: Get a random Magnetic Volumizer.

Junk Jouster (Tier 5 Mech)

  • 6/6. Whenever a minion is Magnetized to this, give your Mechs +3/+1.

Metal Dispenser (Tier 5 Mech)

  • 1/8. Avenge (3): Get a random Magnetic Volumizer.

Apexis Guardian (Tier 6 Mech)

  • 7/4. Deathrattle: Magnetize a 2/2 Green Volumizer to 3 other friendly Mechs.

Expert Aviator (Tier 2 Murloc)

  • 3/4. Rally: Give the left-most minion in your hand +1/+1 and summon it for this combat only.

Costume Enthusiast (Tier 4 Murloc)

  • 3/5. Divine Shield. Start of Combat: Gain the stats of the highest-Attack minion in your hand.

Dramaloc (Tier 6 Murloc)

  • 9/2. Deathrattle: Give two other friendly Murlocs the stats of the highest-Attack minion in your hand.

Profound Thinker (Tier 3 Naga)

  • 4/4. Rally: Get a random Spellcraft spell and cast a copy of it (targets this if possible).

Sunken Advocate (Tier 4 Naga)

  • 2/7. Rally: Give your other Naga +1 Attack permanently. (Improved by each spell you cast this turn!)

Bluesy Siren (Tier 6 Naga)

  • 8/8. Whenever a friendly Naga attacks, cast Deep Blues for +2/+3 on it. (3 times per combat.)

Minted Corsair (Tier 1 Pirate)

  • 1/3. When you sell this, get a Tavern Coin.

Industrious Deckhand (Tier 4 Pirate)

  • 3/5. At the start of your turn, get 2 Tavern Coins.

Visionary Shipman (Tier 5 Pirate)

  • 5/5. After you gain Gold 5 times, get a random Tavern spell. (5 left!)

Cannon Corsair (Tier 6 Pirate)

  • 3/8. After you gain Gold, give your Pirates +1/+2.

Quilled Cabbie (Tier 2 Quilboar)

  • 2/5. After the Tavern is Refreshed, play 2 Blood Gems on its right-most minion.

Briarback Drummer (Tier 4 Quilboar)

  • 5/2. Battlecry: Get a Blood Gem Barrage.

Trench Fighter (Tier 4 Quilboar)

  • 6/6. At the end of your turn, get a Gem Confiscation.
gemconfiscation

Razorfen Flapper (Tier 5 Quilboar)

  • 5/3. Deathrattle: Get a Blood Gem Barrage.

Embalming Expert (Tier 2 Undead)

  • 4/2. After the Tavern is Refreshed, give its right-most minion Reborn.

Ghostly Ymirjar (Tier 2 Undead)

  • 2/5. Avenge (4): Gain a free Refresh.

Spellbound Soul (Tier 4 Undead)

  • 6/2. Has +2/+1 for each Tavern spell you've cast this game (wherever this is).

Wintergrasp Ghoul (Tier 5 Undead)

  • 5/3. Deathrattle: Get a Tomb Turning.

Sepulchral Sergeant (Tier 5 Undead)

  • 8/4. Deathrattle: Give your minions +2 Health. (Improves permanently after this gains Attack!)

Forsaken Weaver (Tier 6 Undead)

  • 4/8. After you cast a Tavern spell, your Undead have +1 Attack this game (wherever they are).

Returning Minions

  • Intrepid Botanist
  • Budding Greenthumb
  • Witchwing Nestmatron
  • Treasure-Seeker Elise
  • Tortollan Blue Shell
  • Unforgiving Treant
  • Arid Atrocity
  • Surf n' Surf
  • Fe
intrepidbotanistbuddinggreenthumbwitchwingnestmatrontreasureseekerelisetortollanblueshellunforgivingtreantaridatrocitysurfnsurf
Last updated: December 1, 2025 at 05:54 PM